Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_20G244900_circ_g.14 |
| ID in PlantcircBase | gma_circ_007831 |
| Alias | gma-circRNA2832 |
| Organism | Glycine max |
| Position | chr20: 47545517-47545860 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_20G244900 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | GLYMA_20G244900_circ_g.13 |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRG93041:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.28225218 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
47545615-47545561(+) 47545586-47545799(-) |
| Potential amino acid sequence |
MALSWLFAPYLFNPSGFEWQKVVEDFRDWTNWLLYRGGIGVKGEESWEAWWEEELVGGCAFVDS ISCLWL*(+) MRVHHLHYSHKQDILSTKAQPPTSSSSHQASQLSSPLTPIPPR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |