Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0268100_circ_g.1 |
ID in PlantcircBase | osa_circ_019062 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 8892564-8893323 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0268100 |
Parent gene annotation |
Similar to T-snare. (Os03t0268100-01) |
Parent gene strand | - |
Alternative splicing | Os03g0268100_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0268100-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.179585976 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8893140-8892610(+) 8893292-8892668(+) 8893289-8893280(-) |
Potential amino acid sequence |
MIENQSPLTTFGGCPLASQPSKPYHAIGFQVFPYLQACEVILRLHRFSEFS*(+) MQLAFKFFPIFRRARLFCACTAFLSSAESFIISADNPSDLLCSLMS*(+) MALMVERLEGSRQKLLMEIDSQSSEIEKLFEENSALSTSYQEAVAVTMQWENQVKDCLKQNEEL RSHLEKLRLEQATLLKTSNTTIQPDGQNETSISFPPEFVTENLSLKDQLIKEQSRSEGLSAEIM KLSAELRKAVQAQNNLARLKIGKNLKANCMIWL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |