Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d005785_circ_g.4 |
ID in PlantcircBase | zma_circ_007322 |
Alias | zma_circ_0000860 |
Organism | Zea mays |
Position | chr2: 188383276-188389291 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d005785 |
Parent gene annotation |
Pentatricopeptide repeat-containing protein |
Parent gene strand | + |
Alternative splicing | Zm00001d005785_circ_g.1 Zm00001d005785_circ_g.2 Zm00001d005785_circ_g.3 Zm00001d005785_circ_g.5 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d005785_T005:6 Zm00001d005785_T003:3 Zm00001d005785_T018:5 Zm00001d005785_T002:5 Zm00001d005785_T001:5 Zm00001d005785_T012:6 Zm00001d005785_T020:6 Zm00001d005785_T021:7 Zm00001d005785_T006:5 Zm00001d005785_T015:5 Zm00001d005785_T019:6 Zm00001d005785_T013:4 Zm00001d005785_T016:5 Zm00001d005785_T014:6 Zm00001d005785_T004:6 Zm00001d005785_T011:6 Zm00001d005785_T008:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.040108702 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
188384254-188383281(+) 188383320-188389226(-) |
Potential amino acid sequence |
MKSSLISIDRTAYTAMVDALLACGSIDGALCIFGDIIKHAGKNNDLRPKPHLYLSIMRAFATRG DVDMVMRFNKRMWLDSVGSISRAAKEETHELLMEAAINNNQLFFQIDLARGLLRRIVNEKECFS WTSRVGLEI*(+) MRKRATRALARLISPGLLYLSKRNILSHLLFFLEAL*(-) |
Sponge-miRNAs | zma-miR827-5p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |