Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G013700_circ_g.1 |
| ID in PlantcircBase | gra_circ_000689 |
| Alias | Chr07:1078097|1078535 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 1078097-1078535 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G013700 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 9 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.007G013700.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.162678436 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1078480-1078535(-) 1078501-1078266(+) |
| Potential amino acid sequence |
MFIGTHETFHLSAKLFCFQALLNFTSKCLPRLWHITLNQSYCFWTLLIFLLRCRANMVVPKKNL ERTRVLLTSAAYVQLKHSDVHRHTRNLSPVSKAILLSGPAELYQQMLAKALAHYFESKLLLLDI TDFSFKMQSKYGCTKKES*(-) MQHSSITPEFAQDSFLVQPYLLCILKEKSVMSKSNSFDSK*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |