Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0516900_circ_g.2 |
| ID in PlantcircBase | osa_circ_034051 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 19923411-19924141 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0516900 |
| Parent gene annotation |
Similar to RNA Binding Protein 45. (Os07t0516900-01);Similar to RNA Binding Protein 45. (Os07t0516900-02);Nucleotide-binding, al pha-beta plait domain containing protein. (Os07t0516900-03) |
| Parent gene strand | + |
| Alternative splicing | Os07g0516900_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0516900-02:4 Os07t0516900-03:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.35691938 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19923792-19923444(+) |
| Potential amino acid sequence |
MGLRLVGSKFGFHGAVLLRTSRLPSRMPTSGMATTMDTNRAMILLTMVHPMHRILVRKTTMDIL AMAITNSSRSPHSSSSNPHNSPHSRLPELPRKQFGE*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |