Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0162766_circ_g.3 |
| ID in PlantcircBase | osa_circ_013299 |
| Alias | Os_ciR8178 |
| Organism | Oryza sativa |
| Position | chr2: 3383540-3385427 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0162766 |
| Parent gene annotation |
Hypothetical conserved gene. (Os02t0162766-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0162766_circ_g.4 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0162766-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.114135779 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3384872-3383551(+) 3385401-3385404(-) |
| Potential amino acid sequence |
MINICKDSFFSALSMAFSYFCQSMFKTPSTPLSLLTN*(+) MLWQKYENAIDKAEKKESLQIFIMHFVQAFKEWEPQYTEQSVDQEPISDDTVLGCSRGHPSEII LILVQEVSQITSFITESSSCSESSPNISEQSSDLMLSSEGLNILECLTIVTRSVHNCRVFSYYG GVQKVTALLKAAVVKLKTLTSLLAADEQLSNKAIDNMKMMQKILVHIVTIISNFMNLEPTATRL TQFVNTTGKTLSNEFLATVTPISAKSAVHDTNWQQKAIVAVMEAGGVNWLVVIVVLKES*(-) |
| Sponge-miRNAs | osa-miR5507 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |