Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d025011_circ_g.1 |
ID in PlantcircBase | zma_circ_010264 |
Alias | Zm10circ00033, GRMZM2G019246_C1 |
Organism | Zea mays |
Position | chr10: 99636972-99637622 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d025011 |
Parent gene annotation |
Polyketide cyclase/dehydrase and lipid transport superfamily pro tein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d025011_T001:3 Zm00001d025011_T003:2 Zm00001d025011_T002:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.313225666 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
99637608-99637021(+) 99637010-99637500(-) 99637503-99637562(-) |
Potential amino acid sequence |
MSHHSSWSHSKMSSQTPISCGL*(+) MGVWEDILLCDQELWWLMRRPRTSSSSWRSTPVTCCTSGGSSTRRTVARRGFT*(-) MMDRTLPTMRYQAWRRDPPSGPPQYRSSTIFEDASPEVVRDFFWDDEFRMKNSWDDMLLQHETL EECTETGTMVVRWVRKFPFFCSDREYIIGRRIWASGKTFYCVTKNCGGSCGGRGRAAAAGGQHR *(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |