Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA031304_circ_g.2 |
ID in PlantcircBase | osi_circ_008248 |
Alias | 9:21568939|21570163 |
Organism | Oryza sativa ssp. indica |
Position | chr9: 21568939-21570163 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA031304 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA031304_circ_g.1 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA031304-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_040267* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21569957-21568957(+) 21568987-21569536(+) |
Potential amino acid sequence |
MIQMATQHHQVILQMKSCMMMGLFKWMVLMNWQRGWQSSI*(+) MHRAKETDAMVKMLSQYKNLCGSRKVRAHYLSHDDVLAGVVNLIKKLKIKRIIIGSSNEHLEHT GSIGYGGSAESLASVHELSDDSNGYTTPPSDFADEIMYDDGVIQMDGADELATWVAKFYISLQM KRRRRCIEPKKRMRWSRCCHNTKTFVDQERLGHITFHTMMFLLVL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | leaf senescence |
Other Information | |
---|---|
References | Huang et al., 2021 |