Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0743500_circ_g.1 |
ID in PlantcircBase | osa_circ_016530 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 31173461-31174309 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0743500 |
Parent gene annotation |
Similar to EDR1. (Os02t0743500-01);EDR1. (Os02t0743500-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0743500-01:2 Os02t0743500-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004281* osi_circ_012289 |
PMCS | 0.284700618 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
31173549-31173518(+) |
Potential amino acid sequence |
MPSLKDLRAQSLSHRVNWEAVLVHRGEDPELMKLDQTALIMSLELRESKPSEFVGNDLVQKLAG LVARHMGGTFFDSEGMLVKYQKMMRYLRTSIGSVVVPLGQLKIGLARHRALLFKVLADNIGIPC RLLKGRQYTGSDDGALNIVKFDDGRISTPLAMMTEYQMGFMISM*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |