Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0743500_circ_g.1 |
| ID in PlantcircBase | osa_circ_016530 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 31173461-31174309 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0743500 |
| Parent gene annotation |
Similar to EDR1. (Os02t0743500-01);EDR1. (Os02t0743500-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0743500-01:2 Os02t0743500-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004281* osi_circ_012289 |
| PMCS | 0.284700618 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31173549-31173518(+) |
| Potential amino acid sequence |
MPSLKDLRAQSLSHRVNWEAVLVHRGEDPELMKLDQTALIMSLELRESKPSEFVGNDLVQKLAG LVARHMGGTFFDSEGMLVKYQKMMRYLRTSIGSVVVPLGQLKIGLARHRALLFKVLADNIGIPC RLLKGRQYTGSDDGALNIVKFDDGRISTPLAMMTEYQMGFMISM*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |