Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA007179_circ_g.1 |
ID in PlantcircBase | osi_circ_003637 |
Alias | 2:1939827|1940780 |
Organism | Oryza sativa ssp. indica |
Position | chr2: 1939827-1940780 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA007179 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA007179_circ_igg.1 BGIOSGA007179_circ_igg.2 BGIOSGA007179_circ_g.2 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA007179-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1940748-1940765(-) 1940706-1939828(+) |
Potential amino acid sequence |
MLYDCNEQLQQFSHVNKKALDQYVNFTEQREQLQRRRAELDAGDQKIRELISVLDQRKDESIER TFKGVARHFREVFSELVQGGHGHLVMMRKKDGDADDDDNDEDGPREPDPEGRIEKYIGVKVKVQ AEK*(-) MTELLQLLIAVIKHLLQLLLIFPLVP*(+) |
Sponge-miRNAs | osa-miR414 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |