Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0658300_circ_g.2 |
| ID in PlantcircBase | osa_circ_035099 |
| Alias | Os_ciR11160 |
| Organism | Oryza sativa |
| Position | chr7: 27715851-27717845 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0658300 |
| Parent gene annotation |
Rho GTPase-activating protein, Target of the E3 ligase SPL11, Ne gative regulation of programmed cell death and innate immunity ( Os07t0658300-01);Splicing isoform of SPIN6 (Os07t0658300-02);Spl icing isoform of SPIN6 (Os07t0658300-03) |
| Parent gene strand | + |
| Alternative splicing | Os07g0658300_circ_g.3 Os07g0658300_circ_g.4 Os07g0658300_circ_g.5 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0658300-01:8 Os07t0658300-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.156342665 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27716387-27715878(+) |
| Potential amino acid sequence |
MGHNGIFRNDTTDPYEGAVPNWREKRPIKSLVVGRPILLALEDIDGSPSFLEKALRFLERHGIK VEGILRQAADVEEVDKRMQEYEQGRTEFAQDEDAHVIGDCVKHVLRELPSSPVPASCCTALLEA FRLESKESRINSMRAAISETFPEPNRRLLQRIPCPREVVK*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |