Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0665000_circ_g.1 |
| ID in PlantcircBase | osa_circ_031887 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 27467859-27468890 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0665000 |
| Parent gene annotation |
Protein of unknown function DUF284, transmembrane eukaryotic fam ily protein. (Os06t0665000-01);Protein of unknown function DUF28 4, transmembrane eukaryotic family protein. (Os06t0665000-02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0665000_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0665000-01:3 Os06t0665000-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.199439713 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27467872-27467871(+) 27467926-27468731(-) |
| Potential amino acid sequence |
MNQPIFVYYQLDNFYQNHRRYVKSRNDGQLRDAAKANQTSACEPEKTTADGKPIVPCGLIAWSL FNDTYSFTRGNENLTVDKKDISWKSDREHKFGKNVYPSNFQNGLLKGGGTLDPAIPLSEQEDLI VWMRTAALPTFRKLYGRIYVDLKKNDTITVKLSNNYNTYNFGGKKKLVLSTATWLGGKNDFLGF AYVIVGGVCFFLAFAFTLLYLIKPRLQRI*(+) MILVEIIKLIVYKNWLIHILCNLGFMRYSKVKANAKKKQTPPTITYANPRKSFFPPSQVAVERT SFFLPPKLYVL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |