Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc12g017830.1_circ_g.2 |
ID in PlantcircBase | sly_circ_003573 |
Alias | 12:7465344|7466356 |
Organism | Solanum lycopersicum |
Position | chr12: 7465344-7466356 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc12g017830.1 |
Parent gene annotation |
Brefeldin A-inhibited guanine nucleotide-exchange protein 5 |
Parent gene strand | + |
Alternative splicing | Solyc12g017830.1_circ_g.1 |
Support reads | 7 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Solyc12g017830.1.1:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.185177361 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7466311-7465395(+) 7465516-7465491(+) |
Potential amino acid sequence |
MKLLLRHVFCPWSYFSSWGIVARSYQGLLQYCS*(+) MLTQMLSIIFRRMENDLGSRSHGSVAHQETTDTNGPNVKVEEVSHNDPEYKEITEGGDAPNVVQ AKDASVASVEELQSFVGGADIKGLEAALEKAVHLGDGEKVTKGIELESMSPGEHDALLLFRTLC KMGIKEDNDEVTVKTRILSLELLQFMGNRCSELSGSVTILLLTAKVL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Yin et al., 2018 |