Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc12g017830.1_circ_g.2 |
| ID in PlantcircBase | sly_circ_003573 |
| Alias | 12:7465344|7466356 |
| Organism | Solanum lycopersicum |
| Position | chr12: 7465344-7466356 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc12g017830.1 |
| Parent gene annotation |
Brefeldin A-inhibited guanine nucleotide-exchange protein 5 |
| Parent gene strand | + |
| Alternative splicing | Solyc12g017830.1_circ_g.1 |
| Support reads | 7 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc12g017830.1.1:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.185177361 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7466311-7465395(+) 7465516-7465491(+) |
| Potential amino acid sequence |
MKLLLRHVFCPWSYFSSWGIVARSYQGLLQYCS*(+) MLTQMLSIIFRRMENDLGSRSHGSVAHQETTDTNGPNVKVEEVSHNDPEYKEITEGGDAPNVVQ AKDASVASVEELQSFVGGADIKGLEAALEKAVHLGDGEKVTKGIELESMSPGEHDALLLFRTLC KMGIKEDNDEVTVKTRILSLELLQFMGNRCSELSGSVTILLLTAKVL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |