Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0712700_circ_g.15 |
| ID in PlantcircBase | osa_circ_021266 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 28818115-28818178 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0712700 |
| Parent gene annotation |
Cytosolic phosphoglucomutase (Os03t0712700-01);Similar to Phosph oglucomutase. (Os03t0712700-02);Similar to Phosphoglucomutase. ( Os03t0712700-03) |
| Parent gene strand | + |
| Alternative splicing | Os03g0712700_circ_g.2 Os03g0712700_circ_g.3 Os03g0712700_circ_g.4 Os03g0712700_circ_g.5 Os03g0712700_circ_g.6 Os03g0712700_circ_g.7 Os03g0712700_circ_g.8 Os03g0712700_circ_g.9 Os03g0712700_circ_g.10 Os03g0712700_circ_g.11 Os03g0712700_circ_g.12 Os03g0712700_circ_g.13 Os03g0712700_circ_g.14 |
| Support reads | 1 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0712700-03:1 Os03t0712700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.2916625 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28818120-28818138(+) 28818130-28818130(-) |
| Potential amino acid sequence |
MPTSAALDVVAKNLNLKFFEEHAHISCP*(+) MWACSSKNLRFKFLATTSRAADVGMLLKELEIQILSDNIKGS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |