Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0220800_circ_g.1 |
ID in PlantcircBase | osa_circ_008881 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 6322641-6323315 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0220800 |
Parent gene annotation |
Similar to 60S ribosomal protein L10 (QM protein homolog). (Os11 t0220800-01) |
Parent gene strand | + |
Alternative splicing | Os11g0220800_circ_g.2 Os11g0220800_circ_g.3 Os11g0220800_circ_g.4 Os11g0220800_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0220800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.638668494 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6322743-6322742(+) |
Potential amino acid sequence |
MKKKGVDEFPYCVHLVSWEKENVSSEALEAARIACNKYMTKNAGKDAFHLRVRVHPFHVLRINK MLSCAGADRLQTGMRGAFGKPQGTCARVDIGQVLLSVRCKESNAKHAEEALRRAKFKFPGRQKI IHSRKWGFTKFTREEYVKLKAEGRIMSDGVNAQGLLGATARSRTSRTPSQGTAVVSLTPRSGSM MLA*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |