Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0483900_circ_g.1 |
| ID in PlantcircBase | osa_circ_009362 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 17030408-17031410 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0483900 |
| Parent gene annotation |
Engulfment and cell motility, ELM domain containing protein. (Os 11t0483900-01) |
| Parent gene strand | + |
| Alternative splicing | Os11g0483900_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0483900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.130677609 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17030498-17030408(+) 17030467-17031399(-) 17030418-17030968(-) |
| Potential amino acid sequence |
MNLTPVQEERLQRLRHRMKVYFDPSRRDHQEALKALWHATYPDQELQGLISEQWKDMGWQGRDP STDFR*(+) MHTQERLFPIHLGDPQDASSEVS*(-) MLHLKSVDGSLPCHPMSFHCSEIKPCSSWSGYVACQRAFNAS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |