Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0511300_circ_g.2 |
| ID in PlantcircBase | osa_circ_011571 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 19702944-19703664 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0511300 |
| Parent gene annotation |
CLT(CRT-like transporter) protein containing no plastid target s ignal peptide (Os12t0511300-01);UAA transporter domain containin g protein. (Os12t0511300-02);UAA transporter domain containing p rotein. (Os12t0511300-03) |
| Parent gene strand | + |
| Alternative splicing | Os12g0511300_circ_g.1 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0511300-03:3 Os12t0511300-01:3 Os12t0511300-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.24735801 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19703587-19702969(+) |
| Potential amino acid sequence |
MAFNIALLNLVKLSSALVASLTATSAGEAPRYLCG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |