Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0511300_circ_g.2 |
ID in PlantcircBase | osa_circ_011571 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 19702944-19703664 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0511300 |
Parent gene annotation |
CLT(CRT-like transporter) protein containing no plastid target s ignal peptide (Os12t0511300-01);UAA transporter domain containin g protein. (Os12t0511300-02);UAA transporter domain containing p rotein. (Os12t0511300-03) |
Parent gene strand | + |
Alternative splicing | Os12g0511300_circ_g.1 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0511300-03:3 Os12t0511300-01:3 Os12t0511300-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.24735801 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19703587-19702969(+) |
Potential amino acid sequence |
MAFNIALLNLVKLSSALVASLTATSAGEAPRYLCG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |