Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.008G093600_circ_g.1 |
| ID in PlantcircBase | gra_circ_000830 |
| Alias | Chr08:23478577|23478850 |
| Organism | Gossypium raimondii |
| Position | chrChr08: 23478577-23478850 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.008G093600 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.008G093600.2:1 Gorai.008G093600.1:1 Gorai.008G093600.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000775 ghi_circ_000762* |
| PMCS | 0.677679258 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23478782-23478842(-) 23478580-23478842(-) |
| Potential amino acid sequence |
MISASGSTLFEELGLYYIGPVDGHNIEDLVAMFEKVKAMPAPGPVLIHIVTEKGKGYPPAEAAI DKMHGPN*(-) MGLTKQIGGQTHEIAAKVDEYARGMISASGSTLFEELGLYYIGPVDGHNIEDLVAMFEKVKAMP APGPVLIHIVTEKGKGYPPAEAAIDKMHGPN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |