Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d035737_circ_g.1 |
| ID in PlantcircBase | zma_circ_008914 |
| Alias | Zm06circ00017 |
| Organism | Zea mays |
| Position | chr6: 44300817-44301076 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d035737 |
| Parent gene annotation |
D-glycerate 3-kinase chloroplastic |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d035737_T001:2 Zm00001d035737_T002:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.152245192 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
44301022-44300975(+) 44300857-44300819(-) 44300847-44300997(-) |
| Potential amino acid sequence |
MNLSQASEYASRFLLTTSSSSSDIPGFPSALIATSACSLHW*(+) MRADGKPGMSDEELEVVNKNLEAYSDAWDRFIQSWIVIKIREPGSVYQWRLQAEVAMRADGKPG MSDEELEVVNKNLEAYSDAWDRFIQSWIVIKIREPGSVYQWRLQAEVAMRADGKPGMSDEELEV VNKNLEAYSDAWDRFIQSWIVIKIREPGSVYQWRLQAEVAMRADGKPGMSDEE(-) MESLECLMRSWRWLTRTLKHTLMLGTGSSSHGLLLK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020 |