Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d035737_circ_g.1 |
ID in PlantcircBase | zma_circ_008914 |
Alias | Zm06circ00017 |
Organism | Zea mays |
Position | chr6: 44300817-44301076 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d035737 |
Parent gene annotation |
D-glycerate 3-kinase chloroplastic |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d035737_T001:2 Zm00001d035737_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.152245192 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
44301022-44300975(+) 44300857-44300819(-) 44300847-44300997(-) |
Potential amino acid sequence |
MNLSQASEYASRFLLTTSSSSSDIPGFPSALIATSACSLHW*(+) MRADGKPGMSDEELEVVNKNLEAYSDAWDRFIQSWIVIKIREPGSVYQWRLQAEVAMRADGKPG MSDEELEVVNKNLEAYSDAWDRFIQSWIVIKIREPGSVYQWRLQAEVAMRADGKPGMSDEELEV VNKNLEAYSDAWDRFIQSWIVIKIREPGSVYQWRLQAEVAMRADGKPGMSDEE(-) MESLECLMRSWRWLTRTLKHTLMLGTGSSSHGLLLK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |