Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0685500_circ_g.3 |
| ID in PlantcircBase | osa_circ_003322 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 28263443-28267074 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0685500 |
| Parent gene annotation |
Similar to DNA ligase. (Os01t0685500-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0685500_circ_g.1 Os01g0685500_circ_g.2 Os01g0685500_circ_g.4 Os01g0685500_circ_g.5 Os01g0685500_circ_ag.1 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0685500-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010571 |
| PMCS | 0.347007952 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28263703-28266124(-) 28263935-28267071(-) |
| Potential amino acid sequence |
MLAWVIAWTWFQLVHGMEMVGKLDGIALFLWRATTLNTKSSKVSAALCLVSQMSSIKRYDGQRA QIHRSNDGSVQIFSRQMKESTSRFPDLVGMIKELCSIEVSSFILDAEVVGIDRKKGNKLMSFQE LSSRERGSKHSSIAIQNIKVDICVFVFDIMFCNGQR*(-) MNTFFKMACQSSCEGIMLKILDVDAGYSASKRCDSWLKVKRDYVGLGDSLDLVPIGAWYGNGRK AGWYSPFLMACYNPEYEEFQSVCRVMSGFSDEFYKEV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |