Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.008G121400_circ_g.1 |
| ID in PlantcircBase | gra_circ_000847 |
| Alias | Chr08:35997299|35997647 |
| Organism | Gossypium raimondii |
| Position | chrChr08: 35997299-35997647 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.008G121400 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4/9 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.008G121400.3:2 Gorai.008G121400.1:2 Gorai.008G121400.2:2 Gorai.008G121400.4:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000717 ghi_circ_000193* |
| PMCS | 0.86705745 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35997577-35997626(-) 35997612-35997349(+) |
| Potential amino acid sequence |
MDCLLSVCDYIVEFTPKSHNLRNGAAVEIMESRQRSDIYINLPALRKLDAMLIQLYLGKI*(-) MAPTSNFAQIQLNEHCIQFSQCWKIDVNI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |