Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0132500_circ_g.3 |
ID in PlantcircBase | osa_circ_026446 |
Alias | Os05circ02026/Os_ciR2433 |
Organism | Oryza sativa |
Position | chr5: 1894189-1894617 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, SMALT, Segemehl, find_circ |
Parent gene | Os05g0132500 |
Parent gene annotation |
Protein of unknown function DUF246, plant family protein. (Os05t 0132500-01);Similar to auxin-independent growth promoter protein . (Os05t0132500-02) |
Parent gene strand | - |
Alternative splicing | Os05g0132500_circ_g.1 Os05g0132500_circ_g.2 Os05g0132500_circ_g.4 Os05g0132500_circ_g.5 |
Support reads | 2/4/2 |
Tissues | leaf/root/shoot, root, pistil |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0132500-01:2 Os05t0132500-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015455 osi_circ_015456 |
PMCS | 0.280935839 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1894591-1894242(-) |
Potential amino acid sequence |
MLLKSKFKLATAIGIVLSMLSLLVHLFLANYSAGGITRYSLHMDDVLPFGPRPRPRRLWGSLST LDHLHPYAKPRKIYPGSGAEINEIRCSSRANSSWPQRLASCCRCYRCWCTFSLRIILLGESQDI VCIWMMSFRLDQGLDPGDCGVR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |