Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G31210_circ_g.11 |
| ID in PlantcircBase | ath_circ_033819 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 15171750-15172226 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT4G31210 |
| Parent gene annotation |
DNA topoisomerase, type IA, core |
| Parent gene strand | + |
| Alternative splicing | AT4G31210_circ_g.12 |
| Support reads | 1/2 |
| Tissues | whole_plant/seedlings |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G31210.2:3 AT4G31210.1:3 AT4G31210.3:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.23204486 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15172209-15172223(+) |
| Potential amino acid sequence |
MATVPKVILKCGPYGHYVQLGEDKKGHTPKRANAAHIKDVNSITLESALELLRYPLTLGTHPED GQPVVLKLSKSGFTIKHRRNMATVPKVILKCGPYGHYVQLGEDKKGHTPKRANAAHIKDVNSIT LESALELLRYPLTLGTHPEDGQPVVLKLSKSGFTIKHRRNMATVPKVILKCGPYGHYVQLGEDK KGHTPKRANAAHIKDVNSITLESALELLRYPLTLGTHPEDGQPVVLKLSKSGFTIKHRRNMATV PK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Pan et al., 2017 |