Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G08900_circ_g.3 |
ID in PlantcircBase | ath_circ_001490 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 2854968-2855189 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G08900 |
Parent gene annotation |
Sugar transporter ERD6-like 2 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G08900.5:2 AT1G08900.1:2 AT1G08900.4:2 AT1G08900.2:2 AT1G08900.3:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.167421733 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2855001-2855186(+) |
Potential amino acid sequence |
MLIVGLVGYVSSFGIGLGGLPWVIMSEKNGEFQKLCSVMLIVGLVGYVSSFGIGLGGLPWVIMS EKNGEFQKLCSVMLIVGLVGYVSSFGIGLGGLPWVIMSEKNGEFQKLCSVMLIVGLVGYVSSFG IGLGGLPWVIMSE(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |