Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G40040_circ_g.2 |
| ID in PlantcircBase | ath_circ_035803 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 18557808-18558236 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | AT4G40040 |
| Parent gene annotation |
Histone H3.3 |
| Parent gene strand | - |
| Alternative splicing | AT4G40030_circ_g.1 4_circ_ag.2 AT4G40030_circ_g.3 AT4G40030_circ_g.4 4_circ_ag.5 AT4G40030_circ_g.6 AT4G40040_circ_g.1 AT4G40040_circ_g.3 |
| Support reads | 13 |
| Tissues | inflorescences, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G40040.3:3 AT4G40040.2:3 AT4G40040.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.299020177 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18558237-18557810(-) |
| Potential amino acid sequence |
MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIR KLPFQRLVREIAQDFKMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVA LREIRKYQKSTELLIRKLPFQRLVREIAQDFKMARTKQTARKSTGGKAPRKQLATKAARKSAPT TGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKMARTKQTARKSTGGKA PRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFK (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |