Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G45000_circ_g.2 |
| ID in PlantcircBase | ath_circ_006060 |
| Alias | At_ciR4228 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 17011061-17011252 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT1G45000 |
| Parent gene annotation |
26S protease regulatory subunit S10B homolog B |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G45000.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.086851331 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17011067-17011249(+) |
| Potential amino acid sequence |
MIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHASGIAKHGEIDYEAIVKLGEVK MIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHASGIAKHGEIDYEAIVKLGEVK MIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHASGIAKHGEIDYEAIVKLGEVK MIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHASGIAKHGEIDYEAIVKLGE(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |