Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | CSA021108_g_circ1 |
| ID in PlantcircBase | csi_circ_003022 |
| Alias | Cs-circRNA599 |
| Organism | Camellia sinensis |
| Position | chrxpSc0053620: 43618-48208 JBrowse» |
| Reference genome | v1 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI2 |
| Parent gene | CSA021108 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | CSA021108_g_circ2 CSA021108_g_circ3 CSA021108_g_circ4 |
| Support reads | NA |
| Tissues | bud |
| Exon boundary | NA-NA |
| Splicing signals | CT-AC |
| Number of exons covered | CSA021108.1:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
47968-48207(-) 48193-43681(+) |
| Potential amino acid sequence |
MLQPNARGPISPEKETLPVSDKDAIVEIMEQHDHFVGSMQSRLGRLQMVHKYWERHDVRGAIGA MEKMADHAVLADVISFLTEKPDIITLDICTYLLPLLAGLLESNMDR*(-) MHTSFICPCCFQEGLRGVAGDKCKYPM*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Tong et al., 2018 |