Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | CSA021108_g_circ1 |
ID in PlantcircBase | csi_circ_003022 |
Alias | Cs-circRNA599 |
Organism | Camellia sinensis |
Position | chrxpSc0053620: 43618-48208 JBrowse» |
Reference genome | v1 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI2 |
Parent gene | CSA021108 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | CSA021108_g_circ2 CSA021108_g_circ3 CSA021108_g_circ4 |
Support reads | NA |
Tissues | bud |
Exon boundary | NA-NA |
Splicing signals | CT-AC |
Number of exons covered | CSA021108.1:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
47968-48207(-) 48193-43681(+) |
Potential amino acid sequence |
MLQPNARGPISPEKETLPVSDKDAIVEIMEQHDHFVGSMQSRLGRLQMVHKYWERHDVRGAIGA MEKMADHAVLADVISFLTEKPDIITLDICTYLLPLLAGLLESNMDR*(-) MHTSFICPCCFQEGLRGVAGDKCKYPM*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Tong et al., 2018 |