Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0182500_circ_g.1 |
| ID in PlantcircBase | osa_circ_026875 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 4959373-4961697 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0182500 |
| Parent gene annotation |
Similar to Ubiquitin carrier protein. (Os05t0182500-01);Rad6 (Ub iquitin carrier protein). (Os05t0182500-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0182500-01:3 Os05t0182500-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.118454706 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4959381-4959374(+) 4961692-4961689(-) 4959452-4961694(-) |
| Potential amino acid sequence |
MSTPARKRLMRDFKRLMQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFTEDYP NKPPTVRFVSRMFHPNR*(+) MKHPRNKSHCRWLVRIIFSKLKCQLERTSIPRSIIRAKNYSIPKHYIVVLWGPTYASWRILHQS FEIPHQPLPCWRRHIHLLG*(-) MPAGGSCISRLKSLINLFLAGVDIFTC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |