Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0412000_circ_g.2 |
| ID in PlantcircBase | osa_circ_006794 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 14343461-14343682 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0412000 |
| Parent gene annotation |
ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter family prot ein. (Os10t0412000-01);Similar to aminophospholipid ATPase. (Os1 0t0412000-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0412000-01:1 Os10t0412000-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.667895908 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14343612-14343463(-) |
| Potential amino acid sequence |
MIQAAHVGIGISGQEGMQAVMASDFAIAQFRYLTDLLLVHGRWSYLRLCKVASLVKKGAHKITL SIGDGANDVSMIQAAHVGIGISGQEGMQAVMASDFAIAQFRYLTDLLLVHGRWSYLRLCKVASL VKKGAHKITLSIGDGANDVSMIQAAHVGIGISGQEGMQAVMASDFAIAQFRYLTDLLLVHGRWS YLRLCKVASLVKKGAHKITLSIGDGANDVSMIQAAHVGIGISGQEGMQAVMASDFAIAQFRYLT DLLLVHGRWSYLRLCK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |