Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0180000_circ_g.1 |
ID in PlantcircBase | osa_circ_013480 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 4451382-4451746 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0180000 |
Parent gene annotation |
Similar to Protein phosphatase type-2C. (Os02t0180000-01) |
Parent gene strand | + |
Alternative splicing | Os02g0180000_circ_g.2 Os02g0180000_circ_g.3 Os02g0180000_circ_g.4 Os02g0180000_circ_g.5 Os02g0180000_circ_g.6 Os02g0180000_circ_g.7 Os02g0180000_circ_g.8 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0180000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.164400137 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4451686-4451445(+) 4451631-4451411(+) |
Potential amino acid sequence |
MISLNLVFRLCKDGVQTWKMLNLLALGETTVEACGLDAPSCL*(+) MGIYLSTPKTDKFSEDGENDKLKLGLSSMQGWRANMEDAEFTSSRRNYG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |