Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0729200_circ_g.1 |
| ID in PlantcircBase | osa_circ_021626 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 29795309-29795668 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0729200 |
| Parent gene annotation |
Similar to predicted protein. (Os03t0729200-01);Thioredoxin-like fold domain containing protein. (Os03t0729200-02);Similar to pr edicted protein. (Os03t0729200-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0729200-02:2 Os03t0729200-01:2 Os03t0729200-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.153972801 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29795337-29795351(-) 29795354-29795628(-) |
| Potential amino acid sequence |
MSHENFHSLASVFSRFDSLKEAVKNYTIEATPDDRASVLQQGGMFVFRGKELIYARKDEGTGDH APLDDVLNICCKAPAA*(-) MILCNQCPMRIFIAWQVCFHDLTPSRRQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |