Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0180000_circ_g.2 |
| ID in PlantcircBase | osa_circ_029905 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 3967254-3968177 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0180000 |
| Parent gene annotation |
Similar to Root determined nodulation 1. (Os06t0180000-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0180000_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0180050-00:4 Os06t0180000-01:5 Os06t0180050-00:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.216392082 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3968151-3967294(+) 3968169-3968081(-) |
| Potential amino acid sequence |
MIWFCHQDISRFEVHHLEAMANF*(+) MAEPDHLIVKPIPNLSRDGRSAAFPFFYIEPKKYENVLRKFFPEHEGPITKIDPIGNSPVIARK ESLARIAPTWMNISIAMKKDPETDKAFGWVLEMYAYAVASALHGVGNILHKEFMIQPPWDLEIG DAFIIHYTYGCDYDMKGKLTYGKIGEWRFDKRSYDSKPPPRNLPLPPNGVPQSVIYLDGRTRSS YCQTYTEFIKGWSFSSFPFLLH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |