Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0205200_circ_g.2 |
| ID in PlantcircBase | osa_circ_033161 |
| Alias | Os07circ04681 |
| Organism | Oryza sativa |
| Position | chr7: 5661519-5661830 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os07g0205200 |
| Parent gene annotation |
Hypothetical conserved gene. (Os07t0205200-01);Similar to TAF5 ( TBP-ASSOCIATED FACTOR 5); nucleotide binding / transcription reg ulator. (Os07t0205200-02) |
| Parent gene strand | + |
| Alternative splicing | Os07g0205200_circ_g.1 Os07g0205200_circ_g.3 |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0205200-01:2 Os07t0205200-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.201217067 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5661523-5661550(+) 5661821-5661748(-) |
| Potential amino acid sequence |
MEVARSLRQNKFRIKLCEYSYELLLQYLHKTQALVVLGIINERIDFQANGSGSIFKAE*(+) MRSLIIPSTTRACVLWRYWRSNSYEYSHSLILNLFCLKDRATSICLKIYAFIDYSKHHKSLCFV EILEKQFI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |