Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0616750_circ_g.2 |
| ID in PlantcircBase | osa_circ_034776 |
| Alias | Os07circ17100 |
| Organism | Oryza sativa |
| Position | chr7: 25430571-25431907 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ie-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
| Parent gene | Os07g0616750 |
| Parent gene annotation |
Hypothetical gene. (Os07t0616750-01) |
| Parent gene strand | - |
| Alternative splicing | Os07g0616750_circ_g.1 Os07g0616750_circ_g.3 Os07g0616750_circ_g.4 Os07g0616750_circ_g.5 Os07g0616750_circ_g.6 |
| Support reads | 3/105 |
| Tissues | panicle/seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0616800-01:4 Os07t0616800-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.168191511 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25430599-25430573(+) 25431847-25430592(+) |
| Potential amino acid sequence |
MGETTGERALTRLHSMRERIGDSLSAHTNELVAVFSRLVNQGKGMLQPHQIIAEYNAAIPEGER EKLKDSALEDVLRGAQEAIVIPPWIALAIRPRPGVWEYLRINVSQLGVEELSVPEYLQFKEQLV DGSTQNNFVLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESMYPLLNFLRAHNY KGMA*(+) MTKRACTPCSTFFVRTTTKGWLEDPSRR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |