Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G37760_circ_g.2 |
| ID in PlantcircBase | ath_circ_017126 |
| Alias | AT2G37760_C1, CircAKR4C8 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 15832867-15833142 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, CIRI2 |
| Parent gene | AT2G37760 |
| Parent gene annotation |
Aldo-keto reductase family 4 member C8 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 26 |
| Tissues | root, whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G37760.7:1 AT2G37760.6:1 AT2G37760.3:1 AT2G37760.1:1 AT2G37760.4:1 AT2G37760.5:1 AT2G37760.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.696447233 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15832903-15833139(+) |
| Potential amino acid sequence |
MPTPEMLTKPDITSTWKAMEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQ QQGLHELCKSKGVHLSIHWPASLKKESLMPTPEMLTKPDITSTWKAMEALYDSGKARAIGVSNF SSKKLTDLLNVARVTPAVNQVECHPVWQQQGLHELCKSKGVHLSIHWPASLKKESLMPTPEMLT KPDITSTWKAMEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQQQGLHELC KSKGVHLSIHWPASLKKESLMPTPEMLTKPDITSTWKAMEALYDSGKARAIGVSNFSSKKLTDL LNVARVTPAVNQVECHPVWQQQGLHELCKSKGVHLS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |