Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G37760_circ_g.2 |
ID in PlantcircBase | ath_circ_017126 |
Alias | AT2G37760_C1, CircAKR4C8 |
Organism | Arabidpsis thaliana |
Position | chr2: 15832867-15833142 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, CIRI2 |
Parent gene | AT2G37760 |
Parent gene annotation |
Aldo-keto reductase family 4 member C8 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 26 |
Tissues | root, whole_plant, leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G37760.7:1 AT2G37760.6:1 AT2G37760.3:1 AT2G37760.1:1 AT2G37760.4:1 AT2G37760.5:1 AT2G37760.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.696447233 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15832903-15833139(+) |
Potential amino acid sequence |
MPTPEMLTKPDITSTWKAMEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQ QQGLHELCKSKGVHLSIHWPASLKKESLMPTPEMLTKPDITSTWKAMEALYDSGKARAIGVSNF SSKKLTDLLNVARVTPAVNQVECHPVWQQQGLHELCKSKGVHLSIHWPASLKKESLMPTPEMLT KPDITSTWKAMEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQQQGLHELC KSKGVHLSIHWPASLKKESLMPTPEMLTKPDITSTWKAMEALYDSGKARAIGVSNFSSKKLTDL LNVARVTPAVNQVECHPVWQQQGLHELCKSKGVHLS(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Chu et al., 2017;Zhang et al., 2019 |