Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0200400_circ_g.1 |
ID in PlantcircBase | osa_circ_026951 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 6271102-6272051 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0200400 |
Parent gene annotation |
Similar to Cytochrome P450 CYP90D10.b. (Os05t0200400-01) |
Parent gene strand | + |
Alternative splicing | Os05g0200400_circ_g.2 Os05g0200400_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0200400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.105891491 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6271112-6271117(+) |
Potential amino acid sequence |
MELKRQKSDVGETLEWTDYMSLTFTQHVITETLRIGNIISGIMRKAVRDVEVKGQGDVVIPKGW CVLVYFRSVHLDANIYDDPYAFNPWRWKERDMAAATANSGSGFTPFGGGQRLCPGLDLARLQTS IFLHHLVTNFTRRTWS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |