Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc11g018550.2_circ_g.1 |
ID in PlantcircBase | sly_circ_003331 |
Alias | 11:8668832|8669188 |
Organism | Solanum lycopersicum |
Position | chr11: 8668832-8669188 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc11g018550.2 |
Parent gene annotation |
protein_coding |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 12 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Solyc11g018550.2.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.617867432 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8669175-8668857(+) 8668843-8669126(-) |
Potential amino acid sequence |
MEQMLKRSLIGTTSSGRFSTFASPKCAASDPDQLKSAREDIKELLKTTSCHPILVRLGWHDAGT YNKNIEDWPQRGGANGSLRFEVELKHGANAETIIDWNNF*(+) MIVSAFAPCFSSTSNLKLPLAPPL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Yin et al., 2018 |