Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d014572_circ_g.5 |
| ID in PlantcircBase | zma_circ_008487 |
| Alias | Zm05circ00048, GRMZM2G414387_C2 |
| Organism | Zea mays |
| Position | chr5: 53956682-53957396 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d014572 |
| Parent gene annotation |
Probable 2-oxoglutarate-dependent dioxygenase DIN11 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d014572_circ_g.1 Zm00001d014572_circ_g.2 Zm00001d014572_circ_g.3 Zm00001d014572_circ_g.4 Zm00001d014572_circ_g.6 Zm00001d014572_circ_g.7 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d014572_T003:4 Zm00001d014572_T006:3 Zm00001d014572_T001:2 Zm00001d014572_T005:2 Zm00001d014572_T002:4 Zm00001d014572_T004:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.063953578 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
53957384-53956979(+) 53957245-53957375(-) 53956706-53957375(-) |
| Potential amino acid sequence |
MGILASRAHMSSSWLTSVRSP*(+) MRGIALALGGAIDAFEGDTAGDPFWVLRLIGYPVDIPEEQRTDTGCGAHTDYGLLTLVNQDDDI CALEAKIPIKF*(-) MMTYVPLRPKYPSNFEVLLENYIKLCRDISRKIMRGIALALGGAIDAFEGDTAGDPFWVLRLIG YPVDIPEEQRTDTGCGAHTDYGLLTLVNQDDDICALEAKIPIKF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |