Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0187800_circ_g.1 |
| ID in PlantcircBase | osa_circ_036185 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 5140696-5141506 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0187800 |
| Parent gene annotation |
Similar to Glucose-6-phosphate/phosphate-translocator precursor. (Os08t0187800-01) |
| Parent gene strand | + |
| Alternative splicing | Os08g0187800_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0187800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.389830621 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5140784-5141497(-) 5140704-5141294(-) |
| Potential amino acid sequence |
MKPKLIWTVDWCQRRPQGQERASQQVAWLQPC*(-) MASTMLKFSSVTAARAHPPMIGRRERYTGTGNVSPRRNLDTKTLNAGSALLIMCVNDTATFDIL TVAATCPIV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |