Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0623500_circ_g.1 |
| ID in PlantcircBase | osa_circ_002750 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 24895303-24895737 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os01g0623500 |
| Parent gene annotation |
ATPase, AAA-type, core domain containing protein. (Os01t0623500- 01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0623500_circ_g.2 Os01g0623500_circ_g.3 Os01g0623500_circ_g.4 Os01g0623500_circ_g.5 |
| Support reads | 4 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0623500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010356 |
| PMCS | 0.150140096 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24895589-24895709(+) 24895347-24895593(-) |
| Potential amino acid sequence |
MSSTSRASSIISTAVQAIHSEQSKLALTSTAFVHLSPTILPNHIRVLSASSRTILLCGPSEAYL QSLAKALANQFSARLLLLDVIDFACKLHHKYGGPSNTQRAVEAGPHQHGVRASEPNDPAQSHPR PLRVQPHHTALRPIRGVPSVAREGSRKPVQCSPAAARCHRLRVQAPS*(+) MHERRAGEGQLRLLAVYCLDRRTYDGACTRSR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |