Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0623500_circ_g.1 |
ID in PlantcircBase | osa_circ_002750 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 24895303-24895737 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os01g0623500 |
Parent gene annotation |
ATPase, AAA-type, core domain containing protein. (Os01t0623500- 01) |
Parent gene strand | + |
Alternative splicing | Os01g0623500_circ_g.2 Os01g0623500_circ_g.3 Os01g0623500_circ_g.4 Os01g0623500_circ_g.5 |
Support reads | 4 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0623500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010356 |
PMCS | 0.150140096 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24895589-24895709(+) 24895347-24895593(-) |
Potential amino acid sequence |
MSSTSRASSIISTAVQAIHSEQSKLALTSTAFVHLSPTILPNHIRVLSASSRTILLCGPSEAYL QSLAKALANQFSARLLLLDVIDFACKLHHKYGGPSNTQRAVEAGPHQHGVRASEPNDPAQSHPR PLRVQPHHTALRPIRGVPSVAREGSRKPVQCSPAAARCHRLRVQAPS*(+) MHERRAGEGQLRLLAVYCLDRRTYDGACTRSR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |