Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0458100_circ_g.1 |
| ID in PlantcircBase | osa_circ_028144 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 22493302-22493603 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os05g0458100 |
| Parent gene annotation |
Similar to FK506-binding protein 4 (EC 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) (p59 protein) (HSP bin ding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506 binding protein) (FKBP59). (Os05t0458100-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 8 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0458100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.250506898 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22493552-22493474(+) 22493360-22493489(-) 22493477-22493596(-) |
| Potential amino acid sequence |
MSGVENFTIFSECAFIMNWVESLAATLHFRMRILACMLFLQLHQPS*(+) MQARIRIRKCRVAARDSTQFIMKAHSLKMVKFSTPLMKTTLFSHLKLGKELSLKHGI*(-) MKVGEVAKITCKPEYAYGSAGSPPEIPPNSL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |