Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G52200_circ_g.2 |
| ID in PlantcircBase | ath_circ_043701 |
| Alias | At_ciR5235 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 21203164-21203358 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI, find_circ, CIRI-full |
| Parent gene | AT5G52200 |
| Parent gene annotation |
Protein phosphatase inhibitor 2 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/4 |
| Tissues | leaf/aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G52200.1:1 AT5G52200.2:1 AT5G52200.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.225007049 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21203312-21203166(-) |
| Potential amino acid sequence |
MQRAEELRNVLNDAAASSSRNSSQGSGGGGWSSSDEEEEEADPMDQDEEGSLSPRGRAFDECVD DMQRAEELRNVLNDAAASSSRNSSQGSGGGGWSSSDEEEEEADPMDQDEEGSLSPRGRAFDECV DDMQRAEELRNVLNDAAASSSRNSSQGSGGGGWSSSDEEEEEADPMDQDEEGSLSPRGRAFDEC VDDMQRAEELRNVLNDAAASSSRNSSQGSGGGGWSSSDEEEEEADPMDQDEE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |