Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0691100_circ_g.2 |
| ID in PlantcircBase | osa_circ_026085 |
| Alias | NA, |
| Organism | Oryza sativa |
| Position | chr4: 35345303-35345401 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI-long |
| Parent gene | Os04g0691100 |
| Parent gene annotation |
Serine/threonine protein kinase, Hyperosmotic stress response (O s04t0691100-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | leaf, root, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0691100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.418144444 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35345310-35345398(+) 35345381-35345397(-) |
| Potential amino acid sequence |
MSVQYKIPEYVHVSQPCRHLLSRIFVANPYKRIMSVQYKIPEYVHVSQPCRHLLSRIFVANPYK RIMSVQYKIPEYVHVSQPCRHLLSRIFVANPYKRIMSVQYKIPEYVHVSQPCRHLLSRIFVANP YK(+) MRERRWRQGWETWTYSGILYWTDMMRL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017; this study |