Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0521300_circ_g.4 |
| ID in PlantcircBase | osa_circ_028563 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 25921613-25921979 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0521300 |
| Parent gene annotation |
Similar to Histidine-containing phosphotransfer protein 4. (Os05 t0521300-01);Similar to Histidine-containing phosphotransfer pro tein 4. (Os05t0521300-02);Similar to histidine-containing phosph otransfer protein 4. (Os05t0521300-03);Similar to kinesin motor protein-related. (Os05t0521300-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0521300-04:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.390499092 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25921870-25921630(+) 25921676-25921978(-) 25921844-25921973(-) |
| Potential amino acid sequence |
MDLRSKAHHFHQCNQQWLIFYLDQEEMVLHDNTPLYYHCVSFS*(+) MDSMFVFLLMVKLVQEKLTQW*(-) MFKFNKVFSPFSSQAEVFSDIQPLIRSVLDGFNVCIFAYGQTGSGKTYTMVI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |