Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d016950_circ_g.1 |
| ID in PlantcircBase | zma_circ_008729 |
| Alias | Zm05circ00108 |
| Organism | Zea mays |
| Position | chr5: 180967509-180967822 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d016950 |
| Parent gene annotation |
NAC30 NAC type transcription factor |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d016950_T002:1 Zm00001d016950_T001:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.412760407 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
180967521-180967577(+) |
| Potential amino acid sequence |
MGDKEWYFFCVKDRKYPTGLKANRATESGYWKATGKDREIFRGKALVGMKKTLVFYTGRAPRGG KTGWVMHEYRLQGKHAAAATSSSLVVPSSVRAGASSKLGRRWATRSGTSSASRTASTRRG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020 |