Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d016950_circ_g.1 |
ID in PlantcircBase | zma_circ_008729 |
Alias | Zm05circ00108 |
Organism | Zea mays |
Position | chr5: 180967509-180967822 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d016950 |
Parent gene annotation |
NAC30 NAC type transcription factor |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d016950_T002:1 Zm00001d016950_T001:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.412760407 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
180967521-180967577(+) |
Potential amino acid sequence |
MGDKEWYFFCVKDRKYPTGLKANRATESGYWKATGKDREIFRGKALVGMKKTLVFYTGRAPRGG KTGWVMHEYRLQGKHAAAATSSSLVVPSSVRAGASSKLGRRWATRSGTSSASRTASTRRG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |