Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc12g055740.1_circ_g.1 |
ID in PlantcircBase | sly_circ_003642 |
Alias | 12:47086512|47087416 |
Organism | Solanum lycopersicum |
Position | chr12: 61728764-61729668 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI, circseq_cup |
Parent gene | Solyc12g055740.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 4 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Solyc12g055740.1.1:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.219902578 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
61729586-61728832(+) |
Potential amino acid sequence |
MSGMNRRQFDLVDTMEYESIEPLDSKTDLFYGTIFGFVDHCTLIMVMPGEN*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | fruit ripening |
Other Information | |
---|---|
References | Yin et al., 2018 |