Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0249200_circ_g.1 |
ID in PlantcircBase | osa_circ_018868 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 7876889-7877402 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0249200 |
Parent gene annotation |
Class I peptide chain release factor domain containing protein. (Os03t0249200-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0249200-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004676* |
PMCS | 0.255002043 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7877210-7876889(+) 7876907-7876889(+) |
Potential amino acid sequence |
MLCRKYRQSLMLHPMYLHPLQKSKRRRLKKFNTKVDMRFNVKEAQWLGERIKERILQTEKNRIN KDGELVISSTKTRTQKGNIEDALQKIQAIIDAASYVPPPPSEEQKKKVEKI*(+) MRFNVKEAQWLGERIKERILQTEKNRINKDGELVISSTKTRTQKGNIEDALQKIQAIIDAASYV PPPPSEEQKKKVEKI*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |