Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0859200_circ_g.2 |
ID in PlantcircBase | osa_circ_004891 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 37155753-37156692 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0859200 |
Parent gene annotation |
Alpha/beta hydrolase fold-1 domain containing protein. (Os01t085 9200-01);Conserved hypothetical protein. (Os01t0859200-02);Alpha /beta hydrolase fold-1 domain containing protein. (Os01t0859200- 03) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0859200-02:3 Os01t0859200-01:3 Os01t0859200-03:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010950 |
PMCS | 0.247926596 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
37155780-37155797(+) |
Potential amino acid sequence |
MVALSKLVLITAVALLGWAYKVARPPPPPILGGPGGPPVSSPRVQLKDGRHLAYREAGVGREIA KYKIIFSHGFASTKESDFPVSQELAEELGIYLLYFDRAGYGDSDANPKRGLKSDATDVEELADK LQLGEKFYVVGTSMGGYVAWSCLNYIPYRLAGVALVVPAVNYWWPMPASVSASAYRKLDVGDRR TFWIAHHMPWLFYAWFNQKWFRISPIVEGKPEAFTEKDWEILAEIQRTGQLDRVRRSTRNSRWL RSPS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |