Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0859200_circ_g.2 |
| ID in PlantcircBase | osa_circ_004891 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 37155753-37156692 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0859200 |
| Parent gene annotation |
Alpha/beta hydrolase fold-1 domain containing protein. (Os01t085 9200-01);Conserved hypothetical protein. (Os01t0859200-02);Alpha /beta hydrolase fold-1 domain containing protein. (Os01t0859200- 03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0859200-02:3 Os01t0859200-01:3 Os01t0859200-03:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010950 |
| PMCS | 0.247926596 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
37155780-37155797(+) |
| Potential amino acid sequence |
MVALSKLVLITAVALLGWAYKVARPPPPPILGGPGGPPVSSPRVQLKDGRHLAYREAGVGREIA KYKIIFSHGFASTKESDFPVSQELAEELGIYLLYFDRAGYGDSDANPKRGLKSDATDVEELADK LQLGEKFYVVGTSMGGYVAWSCLNYIPYRLAGVALVVPAVNYWWPMPASVSASAYRKLDVGDRR TFWIAHHMPWLFYAWFNQKWFRISPIVEGKPEAFTEKDWEILAEIQRTGQLDRVRRSTRNSRWL RSPS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |