Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0311037_circ_g.7 |
| ID in PlantcircBase | osa_circ_027393 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 14195478-14195919 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0311000 |
| Parent gene annotation |
Clathrin adaptor, mu subunit, C-terminal domain containing prote in. (Os05t0311000-01);Similar to delta-COP. (Os05t0311000-02) |
| Parent gene strand | + |
| Alternative splicing | Os05g0310800_circ_ag.1 Os05g0310800_circ_ag.2 Os05g0310900_circ_ag.1 Os05g0310900_circ_ag.2 Os05g0310900_circ_ag.3 Os05g0310900_circ_ag.4 Os05g0310900_circ_ag.5 Os05g0310900_circ_ag.6 Os05g0310900_circ_ag.7 Os05g0310900_circ_ag.8 Os05g0310900_circ_ag.9 Os05g0310900_circ_ag.10 Os05g0310800_circ_g.1 Os05g0311000_circ_g.1 Os05g0311000_circ_g.2 Os05g0311000_circ_g.3 Os05g0311000_circ_g.4 Os05g0311037_circ_g.1 Os05g0311037_circ_g.2 Os05g0311037_circ_g.3 Os05g0311037_circ_g.4 Os05g0311037_circ_g.5 Os05g0311037_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0311037-00:2 Os05t0311000-02:2 Os05t0311000-01:2 Os05t0311037-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.374880694 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14195638-14195479(+) 14195492-14195479(+) 14195635-14195802(-) |
| Potential amino acid sequence |
MDESSLPLSVNCWPSVSGNETYVNIEYEAAEMFDLHNVVISIPLPALREAPSVRQIDGEWRLKT RMYLDLASKHTPISTKICLTVNKLWGQKIQTGHSQVVKMKLLWLSGEFMGWMSHRYLYQSTAGH RYLEMKLMSTLNMRLLRCLTCTMLSYLYHCLHFGRLRVLDRLMESGD*(+) MYLDLASKHTPISTKICLTVNKLWGQKIQTGHSQVVKMKLLWLSGEFMGWMSHRYLYQSTAGHR YLEMKLMSTLNMRLLRCLTCTMLSYLYHCLHFGRLRVLDRLMESGD*(+) MNSPLNQRSFILTTWEWPVWIFCPHNLLTVKQIFVDIGVCFEAKSRYILVFNLHSPSICLTLGA SRSAGNGIDMTTLCRSNISAASYSMLT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |