Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0155700_circ_g.1 |
| ID in PlantcircBase | osa_circ_035906 |
| Alias | Os_ciR11634 |
| Organism | Oryza sativa |
| Position | chr8: 3225226-3226313 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRI, find_circ |
| Parent gene | Os08g0155700 |
| Parent gene annotation |
Similar to DNA-directed RNA polymerase (Fragment). (Os08t0155700 -01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/2 |
| Tissues | root/seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0155700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.206963725 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3226298-3226287(+) |
| Potential amino acid sequence |
MSAMLGCNSEMLGYNLGWALQMWCMGLLGCMTDLVVNMMVR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |